SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014834 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014834
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-39
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-35
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 264-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-34
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014834   Gene: ENSOGAG00000016575   Transcript: ENSOGAT00000016577
Sequence length 405
Comment pep:known_by_projection scaffold:OtoGar3:GL873585.1:1286198:1300595:-1 gene:ENSOGAG00000016575 transcript:ENSOGAT00000016577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAELGSYLLLAVTLLGLGPRAQAMKGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLI
VVAEGSSVLLTFHDFDLEYHDTCDFDFLEIYNGASADKGNLLGRFCGQVPPPPFTSSWHV
MSVVFHSDKHVASRGFAAGYQKDVCGGVLTSLSGALTSPEYPNNYPNNVECRWVIRAAGP
ATIKLVFVDFQVEGNEECTYDYVAVLGGPGPARGHHYCGSTRPPTLVSVGHELQVVFKSD
FNIGGRGFKAYYFSGECQEVYVAVRGNFSSPQYPGSYPNNIRCHWTIRLPPGYRVKVFFL
DLDLEEPNSLTRTCDFDHLAAFDGASEEAPLLGSWCGHNVPPPITSSHNQLLLLLHTDRS
ATRRGFSVAYIGGQLGGCGVLVGEGKALRPGLQPPSCIPPACPDP
Download sequence
Identical sequences H0XFN6
ENSOGAP00000014834 ENSOGAP00000014834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]