SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015015 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015015
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 259-362
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 3 Region: 41-156
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015015   Gene: ENSOGAG00000016774   Transcript: ENSOGAT00000016777
Sequence length 670
Comment pep:known_by_projection scaffold:OtoGar3:GL873773.1:676502:688114:-1 gene:ENSOGAG00000016774 transcript:ENSOGAT00000016777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWLSLGTHHSCCWLISGQPSATPSGQVNTSSAENEPLEPGEQLGVRLVNGSSRCSGTVEV
RLGKSWEPACGALWNGRAAEAVCQALGCGGAEAAAQLTPPTPEFGPAAGNASGVPNVTLA
GVPAVLCSGVEWRLCDVVEHECSGDRKPAWVTCAENRALRVMDGGGPCAGRVEMLERGQW
GSVCDDTWDLEDAHVVCRQLGCGWAVQALPGMHFTPGRGPIHRDQVNCSGAEAYLWDCPG
LPGYHYCGHKEDAGVVCSEHQSWRLTGGTDPCEGQVEVYFRGFWNTVCDSEWYTQEAKVL
CQTLGCGNVVEQPKGRPHSLSGKMFYSCKGEEPTLSDCFWRFNNSNLCRESHAARVLCSG
SRSLHNLSTPEVPASVQPATVEPSVTVKTEAMESQELMLLILCIVLGILLLGSLISIAFI
LLKMKGKYAIPTMVNHQHPPTTIPAVINSYQVVPITIPKEEVPNLPIQVRAPAPADSDSS
SDTDYEHYDFSTQPPVALTTFYNSQRHRVTDEEAHQSRFQMPPLEEGLEELHVSHVPPAN
PGYCVVDPPSLDPQGHARSNSGSSTSSGENYCNNAGNQLPPWNPQVFSLQRNSFLEQPPN
LELAGSRTTFSAGPLADDSSSTSSGSGEWYQNFQPPPPQTPSVEQFGCPGSPSPQPHSTD
TDDYDDIGAA
Download sequence
Identical sequences H0XG37
ENSOGAP00000015015 ENSOGAP00000015015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]