SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015051 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015051
Domain Number 1 Region: 32-100
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000036
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Domain Number 2 Region: 611-658
Classification Level Classification E-value
Superfamily F-box domain 0.000000000131
Family F-box domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015051   Gene: ENSOGAG00000016814   Transcript: ENSOGAT00000016816
Sequence length 748
Comment pep:known_by_projection scaffold:OtoGar3:GL873561.1:3545417:3551696:1 gene:ENSOGAG00000016814 transcript:ENSOGAT00000016816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMEEALQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVP
CLNSDFGCPFTMARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQ
LDMALALQDQRMLLESLKVATIMSKATDKVSESKEQISVKSSVPEVPHTNGLVSVDEESY
GALYQATVETTRSLAAALDILNTATRDMGRLNTSLCASPDEMDEERNERESLQDRNLKDQ
DCLSEDELGAVGGIDHNDTSQNAQSEQNGSSDLLCDLNTRSYGTSALCNGFSLENICTQV
IDQSQNLHGDSKQNKLTNGECAAPDGTSEPSSSLSVAAQLREVIPSSALPNGTVQHILMA
DDEDEGELCWRKVDLGDLRNMDVLSFSHSPSFKFLSNSCWSKPKEDKAVDTSDLEVAEDP
MGLQGIDLITAALLFCLGDSPGGRGISDSRMVDVYHIDFGTQTFSLPSAILATNTVVGEI
ASASACDHANPQLSNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQLFRRKEFSSHFK
NVHGDIHAGLNGWMEQRCPLAYYGCTYSQRRFCPSTQGAKIIHDRHLRSFGVQPCVSTVL
VEPARNCMLGLHSDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSRLMRDVCASLLQSRGMV
ILQWGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNIVEKREE
AIPLPCMCVTRELTKEGRSLRSVLKPVL
Download sequence
Identical sequences H0XG64
ENSOGAP00000015051 ENSOGAP00000015051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]