SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015115 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015115
Domain Number 1 Region: 317-680
Classification Level Classification E-value
Superfamily SIS domain 1.76e-106
Family double-SIS domain 0.000000472
Further Details:      
 
Domain Number 2 Region: 1-207,248-292
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.86e-53
Family Class II glutamine amidotransferases 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015115   Gene: ENSOGAG00000016878   Transcript: ENSOGAT00000016884
Sequence length 680
Comment pep:known_by_projection scaffold:OtoGar3:GL873665.1:4108241:4141781:-1 gene:ENSOGAG00000016878 transcript:ENSOGAT00000016884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHDVKERHIQLVKKRGK
VKALDEELYKQNNMDLKVEFETHFGIAHTRWATHGIPNAINSHPQRSDKGNEFVVIHNGI
ITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNKETEDITFSTLVERVIQQLEGAF
ALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYRTCALENVKNICKTRMKRL
DSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRIKRSASDD
PSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLK
EIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFIS
QSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQ
FISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRSLL
VMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAK
CQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLA
VLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences H0XGB8
ENSOGAP00000015115 ENSOGAP00000015115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]