SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015118 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015118
Domain Number 1 Region: 679-948
Classification Level Classification E-value
Superfamily VPS9 domain 4.18e-46
Family VPS9 domain 0.0056
Further Details:      
 
Domain Number 2 Region: 431-560
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 9.68e-25
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 356-446
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 5.62e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.015
Further Details:      
 
Domain Number 4 Region: 13-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000206
Family DBL homology domain (DH-domain) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015118   Gene: ENSOGAG00000016883   Transcript: ENSOGAT00000016889
Sequence length 953
Comment pep:known_by_projection scaffold:OtoGar3:GL873601.1:7823155:7841085:-1 gene:ENSOGAG00000016883 transcript:ENSOGAT00000016889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSPQEAALLRLEEVFSATLARVNSLVFQPLLSAAPEPSEPQSRECLRLLQQLHRSSQQL
WEVTEESLHSLRERLRHPDSTGLESLLLLRATDHVLQLHIEYIESYTSCLVVQAFQKLAK
RRSEYWRGQRKALRQLLGGMGSEGSVGPALLQAFRQPLTHHVQQYVLLLLRLEDTVPEYH
PARELVVNAATLFGNLQSFMSQALDQAMATQALWHTLSSRQRHVLCTPAHRLLQDSEDVP
VTVTPLRAERVMLFDDALILLQGHNIHTFDLKLVWVNPGQDRCTFHLLTPEEELSFRTKD
PQGQAVWQWKVTQAVCQALRGKKDFPVLGAGLEASEPPACRCGAYTFHAEGRFCQATYEG
EWCQGRPHGKGTLKWPDGQNHVGDFRQGLEHGFGIRLLPQASEDRFDCYKCHWREGSMSG
YGICEYGTDEVYKGYFQEGLRHGFGVFESALQAARPFRYTGHWEKGQRSGYGIEEDSDRG
ERYIGMWQADQRHGPGVVVTQAGVCYQGTFHADKMVGPGILLSEDDSLYEGTFTKDLTLM
GKGKVTFPNGFTLEGSFGSGAGRGLHTQGVLDTAALPLDPSSTCKRQLGLGAFPVESRWQ
GVYAPFRDFVGAGCPGDLQEALLGFQVQSSRELRKSQDYLCCERTCPEDSVGTIEDILEE
LLQHREPKALQEHLRKALSNTLHPLGKLLQTLMRTFQATYAGVGANKHLQELAQEEVKQH
AQELWATYRGLLHVALQRKGQAPEEDEDAETRDLQVHGLMLPLVLPSFYSELFTLYLLLH
EREDSLYSQGITNLSLFPDTKLLEFLEVQKHLWPLKDLTLTTNQRYSLVRDKCFLSATEC
LQKIMTTVDPREKLEVLERTYGEIEATVSRVLGQEHKLPMDDLLPLLIYVVSRARIQHLG
AEIHLIRDMMNPIHIGGLYDFLLTALESCYEHLQKEDMRLHHFPGHWDSRELW
Download sequence
Identical sequences H0XGC1
ENSOGAP00000015118 ENSOGAP00000015118 XP_003794574.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]