SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015166 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015166
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily F-box domain 0.000000000458
Family F-box domain 0.005
Further Details:      
 
Domain Number 2 Region: 84-397
Classification Level Classification E-value
Superfamily RNI-like 0.00000000471
Family 28-residue LRR 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015166   Gene: ENSOGAG00000016939   Transcript: ENSOGAT00000016943
Sequence length 443
Comment pep:known_by_projection scaffold:OtoGar3:GL873664.1:1182136:1185406:1 gene:ENSOGAG00000016939 transcript:ENSOGAT00000016943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEESELIQPQDQSCWATLPDVCLRRVFWWLGDRDRSRAALVCRKWNQMMYSADLWRYRT
ITFSGRPSRVHASEFESALWYVKKFGRYLEHLEIKFLNPYNTVLTKKFQVTMRGLLSCLG
RSNSRLKSLSIQHLELDRLVWRNSIRSSFIKSLSFFLKKMGKHLDYLNLKGARLTVEQGC
HILNSLSYQRNESLVSELNIEDYFSHHLAVYSSPQFHKTMGTFHNLTALTLNYNCISDEL
LENLCENNASTLWTINIKCHIHDPHGQVIWGMSWAKLARQATNLKVNFFFERVMKYERLA
RILLQEIPVRSISLRSCYFSDPDWSMRPTLTDLLPTFRHTLQKLTFEFNNNHESLDEELH
LLILSCRKLFYFKIWAFLDVKFVERILKSQEEGQCSLRTLKVRIYTNRYETNEEDRTLRD
IYRKYRKLIDSELNYFVIAYPMM
Download sequence
Identical sequences H0XGG0
ENSOGAP00000015166 ENSOGAP00000015166 XP_003799087.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]