SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015223 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015223
Domain Number 1 Region: 80-284
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-50
Family DBL homology domain (DH-domain) 0.000000338
Further Details:      
 
Domain Number 2 Region: 271-433
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-33
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 530-623
Classification Level Classification E-value
Superfamily SH2 domain 5.16e-17
Family SH2 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 477-558
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000421
Family SH3-domain 0.00043
Further Details:      
 
Domain Number 5 Region: 3-118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000185
Family Calponin-homology domain, CH-domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015223   Gene: ENSOGAG00000016999   Transcript: ENSOGAT00000017007
Sequence length 624
Comment pep:known_by_projection scaffold:OtoGar3:GL873529.1:3428348:3641048:1 gene:ENSOGAG00000016999 transcript:ENSOGAT00000017007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIETLSRLSRTPIALATGIRPFPTEESVNDEDIYKGLPDLIDETHVEDEEDLYDCVYGED
DGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLT
AAEFDSVFINIPDLVKVHRSLMQEINDSIVNKIDQNLYQVFINYKEKLVIYGQYCSGVEL
AISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTD
PTEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEI
RITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSY
GFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSC
KVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGRVNSGEPGTLKLPEKRTNGLRRHP
RPVDPGLPKMQVIRNYSGTPPPALHEGPPLYIQAGDTVELLRGDAHSLFWQGRNLASGEV
GFFPSDAVKPSPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYA
ISIKYNNEAKHIKILTRDGLFHIA
Download sequence
Identical sequences H0XGL0
ENSOGAP00000015223 ENSOGAP00000015223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]