SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015376 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015376
Domain Number 1 Region: 380-572
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-47
Family cAMP-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 134-379
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-37
Family Voltage-gated potassium channels 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015376   Gene: ENSOGAG00000017165   Transcript: ENSOGAT00000017170
Sequence length 664
Comment pep:known_by_projection scaffold:OtoGar3:GL873709.1:1299517:1305130:-1 gene:ENSOGAG00000017165 transcript:ENSOGAT00000017170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKSNGVKSSPANNHNHHAAPAIKANGKDEHRTSSRPQSAADDDTSSELQRLADMDGPQ
RGRGGFRRIARLVGVIREWANKNFREEEPRPDSFLERFRGPELQTVTTQQGDAKGDKDGE
GKGTKKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDY
FSDVVYITDLFIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGI
HSPELRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYVYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIKWFDYLWTNK
KTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEK
LEQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPEPEA
EEKP
Download sequence
Identical sequences H0XGZ7
XP_003800982.1.62490 ENSOGAP00000015376 ENSOGAP00000015376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]