SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015390 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015390
Domain Number 1 Region: 596-784
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-53
Family DBL homology domain (DH-domain) 0.00000000821
Further Details:      
 
Domain Number 2 Region: 789-929
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-39
Family Pleckstrin-homology domain (PH domain) 0.000000131
Further Details:      
 
Domain Number 3 Region: 286-424
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-17
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 1083-1136
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000299
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 5 Region: 41-193
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000628
Family CRAL/TRIO domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000015390
Domain Number - Region: 437-525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0911
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015390   Gene: ENSOGAG00000017180   Transcript: ENSOGAT00000017185
Sequence length 1179
Comment pep:known_by_projection scaffold:OtoGar3:GL873680.1:839770:933444:-1 gene:ENSOGAG00000017180 transcript:ENSOGAT00000017185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFWLRHDEMALEEMVQRLSAVSTRTDEIMHQDIVPLCAADIQDQLKKRFAYLSGGRGQD
GSPVITFPDYPAFSEIPDKEFQNVMTYLTSVPSLQDAGIGFILVIDRRRDKWTSVKASVL
RIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGYIDKS
QLTEDLGGTLDYCHTRWLCHRTAIESFALMVKQTAQMLQSFGTELAETELPNDIQSTSSV
LCAHTEKKDKVKEDLRLALEEGRSVLESLRTPLAEGLEHSVNQDQLDNQTTVQRLLAQLN
ETEAAFDEFWAKHQQKLQQCLQLRHFEQGFREVKAALDVVSQKIATFTDVGNSLAHVEHL
LKDLSSFEEKSSVAMGRARALCLDGEQLIENKHYAIDSIRPKCEELRHLCDQFTAEVGRR
RGLLTKALGLHSLLETSMKWCDQGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENK
IQELSNIYKEYESILNQDLMEHVRKVFQKQESMEEMFHRRQASLKKLAAKQTRPVQPVAP
RPEVLTKSPCPSPGMRRGSENSSSEGSTLRRGPYRRVKSEMSGSRQGRSSSAGDEEESLA
VLRRHVMNELLDTERAYVEELLCVLEGYAAEMDNPLMTHLISTDLHNKKDILFGNMEEIY
HFHNRIFLRELEGYVDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPFFQE
CQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKSCEGAEGLQEALSSILGILKAVN
DSMHLIAITGYDGNLGDLGRLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAV
LFCKKREENGEGYEKAPSYSYKQSLDMTAVGITENVKGDAKKFEIWYNAREEVYIIQAPT
PEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPASSNTSPLQGNTRNIKKLEE
RKTDPLSLEGYVSPAPLPKPPEKGRDDVVTSSTSESSALSRKRFTLQGLANIKASPTSPD
KKAKRHEVKSDPTPFGLRGWSKTLPSPEAPMDDGEWSSAEEPVNSSDAEEDVSSPPKKLV
LGTHAVVVGHEEGGPDTLAVRSGNTVELIQEGDEGRWFVRDPSTGKEGWVPASSLSAPLG
KSSSTQCLSSSESSPGSAVLSNSSSCSDSGQAPFADLQG
Download sequence
Identical sequences H0XH08
ENSOGAP00000015390 ENSOGAP00000015390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]