SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015442 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015442
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000036
Family SIAH, seven in absentia homolog 0.01
Further Details:      
 
Domain Number 2 Region: 568-614
Classification Level Classification E-value
Superfamily F-box domain 0.00000235
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015442   Gene: ENSOGAG00000017238   Transcript: ENSOGAT00000017243
Sequence length 707
Comment pep:known_by_projection scaffold:OtoGar3:GL873608.1:4219134:4225241:-1 gene:ENSOGAG00000017238 transcript:ENSOGAT00000017243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPWFVQGRARRPPPEQHRHCEGCFNRHCHAPVEPKISCLVISCHLLCGATFHMCKEAEHE
LLCPLEQVPCLNSQYGCPLSMSRHKLAKHLQACPASVVCCSMEWNRWPNVDSETTLHENI
MKEPPSEECLDTALALQDQKVLFRSLKMVELFPETREAAEEEPDVNGEASLEDMGGAVGG
VGAGLVPHSCLPATNGDAAELTQEEREALAKTKEGMDLHKFGQWENMFSKEHAASALANS
SGSCESKSRNGPGEEQISRGNVAKGEGTANGKEPQDLHTVMETTGLAPWQDGVLERLKTA
VDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGNLEAQEVKTVHTFRVPVSYCGKRA
RIGDAMLSCRPSEHKAVDTSDLGITVEDLPKSDLIKTTLQCALERELKGHVISESRSIDG
LFVDFATQTYNFEAEQFSAGTVLADLTTASPRGLHVELHSECVTRRHNKSSSAFTFTCNK
FFRRDEFPLHFKNVHTDIQSCINGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQELK
TFAIKPEVAPELSEGKKNKHLSGHRGKSQNGLTSLPLEILQYIAGFLDSISLSQLSQVSV
LMRNICATLLQERGMVLLQWKKKRYSHGRSSWRVHREIWQFSSLFSKIKSWEFNEVTSMS
EHLKACPFNIVEHKTDPVLLTSMCQPREQAPESLVSTFRARARGRYA
Download sequence
Identical sequences H0XH54
ENSOGAP00000015442 ENSOGAP00000015442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]