SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015497 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015497
Domain Number 1 Region: 180-372
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.51e-40
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 41-145
Classification Level Classification E-value
Superfamily POZ domain 3.59e-32
Family Tetramerization domain of potassium channels 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015497   Gene: ENSOGAG00000031295   Transcript: ENSOGAT00000027908
Sequence length 372
Comment pep:known_by_projection scaffold:OtoGar3:GL873556.1:8234239:8235357:-1 gene:ENSOGAG00000031295 transcript:ENSOGAT00000027908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDSLIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLG
Download sequence
Identical sequences H0XHA7
ENSOGAP00000015497 ENSOGAP00000015497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]