SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015510 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015510
Domain Number 1 Region: 36-206
Classification Level Classification E-value
Superfamily MIR domain 1.57e-56
Family MIR domain 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015510   Gene: ENSOGAG00000031396   Transcript: ENSOGAT00000027679
Sequence length 221
Comment pep:known_by_projection scaffold:OtoGar3:GL873737.1:515640:518103:1 gene:ENSOGAG00000031396 transcript:ENSOGAT00000027679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSAGRGGAVGTALLGLLLALLVPGGGAATTGAGLVTCGSVLKLLNTQHRVRLHSHDIKY
GSGSGQQSVTGVEASDDANSYWRIRGGSESGCPRGSPVRCGQAVRLTHVLTGKNLHTHHF
PSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGKHWERQAVVRFQHVGTSVFLSVTGEQYGS
PIRGQHEVHGMPSANTHNTWKAMEGIFIKPSVEPSAGHDEL
Download sequence
Identical sequences H0XHC0
ENSOGAP00000015510 ENSOGAP00000015510 XP_003801735.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]