SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015580 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015580
Domain Number 1 Region: 916-1024
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 370-476
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000496
Further Details:      
 
Domain Number 3 Region: 25-133
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00048
Further Details:      
 
Domain Number 4 Region: 781-890
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0034
Further Details:      
 
Domain Number 5 Region: 1023-1127
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 6 Region: 235-343
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0025
Further Details:      
 
Domain Number 7 Region: 134-240
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 
Domain Number 8 Region: 680-786
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015580   Gene: ENSOGAG00000028448   Transcript: ENSOGAT00000031785
Sequence length 1128
Comment pep:novel scaffold:OtoGar3:GL873623.1:1395461:1484126:-1 gene:ENSOGAG00000028448 transcript:ENSOGAT00000031785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGHLFLQGLCFLLLSTLMGAQDVELRLENGGHRCEGRVELKHQGEWGTVDDYDWELQ
AAEVVCRQLGCGTAVEAPKGPHFGSGVGPIWLGYIVCQGNESNVNHCRHSPFEDLLNFGY
SRSWTAGVVCSGFVRLVGGDGPCSGQVEVNSEGDWIPVSDGNFTFPTAQVICAELGCSKA
ESVLGNVSFREASVRVWAEEFQCEGKESGLWFCPRVPCPGGTCHHSGTAQIICSEYTEVR
LMKNGSSQCEGQVEMNISGHWRPLCASYWSMANANVLCRQLSCGVAMSTPQGEFFVEGGN
GIWKDQFHCSGAEPSLWHCPVTTLVGPDCNCVNTASVICSGNKTQLLPRCNDSLSDSAGS
VTSEESAANCSERPYLRLVDGGSPCAGRVEIYHEDSWGTICDNSWDLSDAHVVCRYLGCG
EALDALGSAAFGAGSGPIWLDELQCTGKESYIWKCPSQGWGNHDCSDRMDAGVICSVSIA
VPSFSSGQFCSSLEDWRRGNWGIGIGNGSCEKTLLRVQVESGESQSVHLGEFCMASFLPQ
ERRMSCKKDSSLRSSPGDDILLNDLPKDTVYLYNKTPRKVSRTHKDLKCESRISILLSTS
WATQCSDANCITTARVADKEAFHGHVSNIYPGTLNLLLDNYGCRAHLSLLFSWPGLSLNQ
SALVHVAGAGTTVLCVSRFVHLVGGVGPCSGRVEVNSGGGWTPISGGNFIFSTAQVICAE
LGCGKPASVLEDVSFIKASGQLWTEEFQCQGQESRLWLCPRAPCAGGTCLHSGAVQIICS
EYTEVRLMKNGTFQCEGQVEMNIFGDWRPFCASHWSMANANVLCRQLGCGVAMSTPQGAY
IVEEETRIWKDRFHCSGTEPFLWHCPVTALGSPDCNHGNTASVICSGNQTQLLPQCNDSV
SDSAGSVILEESAANCSENRRLRLVDGGSRCAGRVEIYHEGSWGTICDDGWDLNDAHVVC
RQLDCGEALGALGFAHFGKGSGPIWLDDVNCTGKEAHVWRCPSRGWGQHNCRHKEDAGVT
CSEFLALRLVSRDQQCAGWLEIFYNGTWGSVCHSPMEAMTVSTICRQLGCGDSGTLNSSV
AIREGSRPRWVDVIQCRKTATSLWQCPSNPWKYRSCSSSEEAYITCAG
Download sequence
Identical sequences H0XHJ0
ENSOGAP00000015580 ENSOGAP00000015580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]