SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015607 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015607
Domain Number 1 Region: 557-622
Classification Level Classification E-value
Superfamily F-box domain 0.0000000981
Family F-box domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015607   Gene: ENSOGAG00000015412   Transcript: ENSOGAT00000015415
Sequence length 693
Comment pep:known_by_projection scaffold:OtoGar3:GL873600.1:65212:67293:1 gene:ENSOGAG00000015412 transcript:ENSOGAT00000015415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLKLYWRHQKRERPLEVNRRTLRLPMSHQKALSDEKWKASLMKPLVSLGKAPSQKPLGI
LSPDVLCSMSGKNPVESSLNIKTRKNVPSTTIHQGEEGALDIWAVVKPGNTKEKIAFFAA
HQCNTRTGSMKIKSSWDIDGRATKRRKKSGDLIKAKLQLESMREVSSRCHQPEPFACGIK
HCSVHYVSDSGDGVYTGRPLSVIQMVAFLEQRASALLASCAKNCTNSPAVVRFPGQSRGA
PPASEHFSAPGACEPIERGNPEVGEPQSEPVRVLDIVARLESECLRQQSQHELGSLSRNN
SFHRSAGGVLLSNSTQADEGKTGKGAVEAPATQVDPTGSASVACVPSGAGHSPNGDKTWD
GTSQGHLSLRAGVSFHMDDTELEPSLQITMKNSNRTDVEMTDELVRLPFPSHVCPQAAEL
PTDAVDCMNRALVPLTSPSLDQRRKVSLCVGIPMSKVEKDQPSSLDACEDPLPGMLFFLP
PGQHSDCSQLSESTRKVASESSQLAVSDSTSEPLVPPPSSVESASPVLEASSWKKQVSHD
FLETRFKIQQLLEPQQYMVFLPHHIMVKIFRLLPTKSLVALKCTCYYFKFIIEHYNIRPS
DSRWVRDPRYREDPCKQCKKKYVRGDVSLCRWHPKPYCQAFPYGPGYWMCCHRSQKAFPG
CQLGLHDNRWVPACHSFNREIHKKSKGTETEEE
Download sequence
Identical sequences H0XHL7
ENSOGAP00000015607 XP_003794442.1.62490 ENSOGAP00000015607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]