SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015620 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015620
Domain Number 1 Region: 79-119
Classification Level Classification E-value
Superfamily F-box domain 0.0000899
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015620   Gene: ENSOGAG00000003337   Transcript: ENSOGAT00000003341
Sequence length 283
Comment pep:novel scaffold:OtoGar3:GL873844.1:108520:109454:1 gene:ENSOGAG00000003337 transcript:ENSOGAT00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNPIANTVQQEIKSLCGLKASQLPAEEALSGAGEPCDIIDSSNEIDAQAESTHERTVSRK
KKSKRHKKDLDGAGGEEYPMDIWLLLASYICPKDIVNFSLICKNVWTVVCTDTFWPSCTR
HSTLDASLPLCLLPESSYHMCEPFAARISKNPAFPESFWYRKTIGNRQEPMWEFNFKLKQ
KSPRLKSECMGGLQPPIQYEDVHTNPDQDFCLLQTVLNFIFIPVVMEMIFTLFTIVSTDM
RHHQVRLVLQDSPVHGVHEQGIQVILDQCRAFDHPQYPFSLTA
Download sequence
Identical sequences H0XHN0
ENSOGAP00000015620 ENSOGAP00000015620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]