SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015662 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015662
Domain Number 1 Region: 151-398
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.77e-36
Family WD40-repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 23-76
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000733
Family F-box domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015662   Gene: ENSOGAG00000033125   Transcript: ENSOGAT00000030584
Sequence length 411
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:18978126:19086755:1 gene:ENSOGAG00000033125 transcript:ENSOGAT00000030584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGAAMAAAEEAAVAQESAARPAAGPALWRLPEELLLLICSYLDMRALGRLAQVCRWLRRF
TSCDLLWRRIARASLNSGFTRLGTDLMTNVPVKDRVKVSQNWRLGRCREGILLKWKCRQM
PWMALEDDSLYISQANFILAYQFRPDGASLNRQPLGVFAGHDEDVCHFVLANSHIISAGG
DGKIGIHKIDSTFTVKYSAHEQEVNCVDCKGSIIVSGSRDKTAKVWPLALGQLGQCLHTI
QTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLVTHLGSDFPPGAGVLDVMY
ESPSTLLSCGYDTYVRYWDLRTSVRKCVMEWEEPHDSTLYCLQTDGNHLLATGSSYYGVV
RLWDRRQRACLHAFPLTSTPLSSPVYCLRLTTKHLYAALSYNLHVLDFHNP
Download sequence
Identical sequences H0XHS2
ENSOGAP00000015662 ENSOGAP00000015662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]