SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015682 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015682
Domain Number 1 Region: 187-387
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000051
Family 28-residue LRR 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015682   Gene: ENSOGAG00000025750   Transcript: ENSOGAT00000025634
Sequence length 464
Comment pep:novel scaffold:OtoGar3:GL873681.1:706531:707951:-1 gene:ENSOGAG00000025750 transcript:ENSOGAT00000025634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQGVPRLLDLAVQSLVRNEVLAIFALEELPRELFPPLFLEAFARRHSRVLTAMVQAWP
FTRLPLGSLMKLPDVEMLEVVLDGLVALLTQRVRPRRWKLQVLDLQDVDENFWIMWSEGV
AHTCSPNTLGKRKTGINYPGSGREKPFKVIVDVCFHVGTLGKSLKCFSVWAKQRKDFAHL
CCRKLDILAVALQNIRNSLQMVALDCIQEVDVKWPWKLPTLGRFASYLGHMHHLKKLVVS
HISAPAYLSPEMMKYVLQFASGLLNLNRLQKLDRHPDQVLRCLGTPLETLSISHCPLVKS
DVSHLSWCPTLTQLKHLALTNVRLTPEPLQLLLERVTVTLQTMDLDYYGISDAQLRVILP
SLSHCQLTTFSFCRNQIFMPALEDLIRHTVGQSKFSRGQYPVPLESYDTWGTFYQETLAL
FAAKLRQTLSALQSNRIFFGKVPCIECGGRALYDLDMVQVRQCC
Download sequence
Identical sequences H0XHU2
ENSOGAP00000015682 ENSOGAP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]