SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015701 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015701
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.63e-35
Family Chaperone J-domain 0.00018
Further Details:      
 
Domain Number 2 Region: 245-322
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 6.28e-17
Family HSP40/DnaJ peptide-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 100-155,202-247
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000000301
Family HSP40/DnaJ peptide-binding domain 0.0012
Further Details:      
 
Domain Number 4 Region: 131-194
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0000000000196
Family DnaJ/Hsp40 cysteine-rich domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015701   Gene: ENSOGAG00000033281   Transcript: ENSOGAT00000024267
Sequence length 388
Comment pep:novel scaffold:OtoGar3:GL873629.1:2743347:2744642:-1 gene:ENSOGAG00000033281 transcript:ENSOGAT00000024267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKETSYYNVLGVKPNATHEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDGKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFVGGGRMQRERRGKNVAHQLSVTLEDLYN
GATRTLALHKNVICDKWEGRGGKKGALECCPNCRGTGMQTRIHQIGPGMVQPIQSVCMEC
QGHGEWISPKDRCRVAPVAQKKILEVHIDKGMKDTFHGEGDQEPGLEPGDIIIVLNQKDH
AVFTRREDLCMHMDIQLVEALCGFQMPISTLDNRTTVITSHPGQIVKHGDMKRVLNEGMP
IYHRPYKKGRLIIKFKVNFPENGFLSPDKLSLLEKLLPERKEAEGTDEMDQVDLVDFDPN
QERRRHYNGQAYEDAEHQPRGGVQCQTS
Download sequence
Identical sequences H0XHW1
ENSOGAP00000015701 ENSOGAP00000015701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]