SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015840 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015840
Domain Number 1 Region: 166-362
Classification Level Classification E-value
Superfamily E set domains 1.31e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.000002
Further Details:      
 
Domain Number 2 Region: 49-181
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.44e-22
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015840   Gene: ENSOGAG00000031573   Transcript: ENSOGAT00000024244
Sequence length 424
Comment pep:known_by_projection scaffold:OtoGar3:GL873576.1:1862497:1870567:-1 gene:ENSOGAG00000031573 transcript:ENSOGAT00000024244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPRARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKGGLESAVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLIVPKVQFMTPEGNQN
TSES
Download sequence
Identical sequences H0XIA0
ENSOGAP00000015840 XP_003792500.1.62490 ENSOGAP00000015840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]