SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015855 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015855
Domain Number 1 Region: 304-332,364-565
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-59
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 177-273
Classification Level Classification E-value
Superfamily POZ domain 8.9e-27
Family Tetramerization domain of potassium channels 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015855   Gene: ENSOGAG00000033403   Transcript: ENSOGAT00000026339
Sequence length 654
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:57081318:57083282:-1 gene:ENSOGAG00000033403 transcript:ENSOGAT00000026339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGPGGG
SHHHHQSRGACTSHDPQSSRGSRRRRRQRPEKKKAHHRQGGFPHCSDLMPSGSEEKILRE
LSEEEEEEDEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDDAGGGGYSSVRYSDCCERVV
INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG
RLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY
PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSGLLNDTSAPHL
ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL
GTDLAQQQGGGSGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG
LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS
STSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDESETDKNNCSNAKAVETDV
Download sequence
Identical sequences H0XIB5
ENSOGAP00000015855 ENSOGAP00000015855 XP_003781250.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]