SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015867 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015867
Domain Number 1 Region: 294-365
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-17
Family PCI domain (PINT motif) 0.0000322
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000015867
Domain Number - Region: 131-214
Classification Level Classification E-value
Superfamily TPR-like 0.0398
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015867   Gene: ENSOGAG00000027198   Transcript: ENSOGAT00000032086
Sequence length 406
Comment pep:known_by_projection scaffold:OtoGar3:GL873558.1:6605804:6653262:-1 gene:ENSOGAG00000027198 transcript:ENSOGAT00000032086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGADQLEALKAFVEQVVNENVSLV
ISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDW
RNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTN
EQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEALKHALHCTILASAGQ
QRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSIL
DRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVH
FETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ
Download sequence
Identical sequences H0XIC7
ENSOGAP00000015867 ENSOGAP00000015867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]