SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015878 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000015878
Domain Number - Region: 51-94
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000432
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015878   Gene: ENSOGAG00000033696   Transcript: ENSOGAT00000034357
Sequence length 119
Comment pep:novel scaffold:OtoGar3:GL873748.1:2002839:2006111:1 gene:ENSOGAG00000033696 transcript:ENSOGAT00000034357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQ
Download sequence
Identical sequences H0XID8
ENSOGAP00000015878 ENSOGAP00000015878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]