SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015931 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015931
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.05e-32
Family Ribosomal proteins L24p and L21e 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015931   Gene: ENSOGAG00000027159   Transcript: ENSOGAT00000032559
Sequence length 160
Comment pep:novel scaffold:OtoGar3:GL873530.1:12601669:12602151:1 gene:ENSOGAG00000027159 transcript:ENSOGAT00000032559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGKPHKCYHGK
TGRVYSVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAK
EEGTWVQLKCQPAPPGEARIVRTNGKEPELLEPIPYEFMA
Download sequence
Identical sequences H0XIJ1
ENSOGAP00000015931 ENSOGAP00000015931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]