SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015939 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015939
Domain Number 1 Region: 7-59
Classification Level Classification E-value
Superfamily F-box domain 0.00000000275
Family F-box domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015939   Gene: ENSOGAG00000025353   Transcript: ENSOGAT00000033786
Sequence length 141
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:15856116:15859885:1 gene:ENSOGAG00000025353 transcript:ENSOGAT00000033786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWPPLTMHITQLNRECLLHLFSFLDKDSRKNLARTCSQLHDVFEDPTLWPLLHFRSLTEL
KKDNFLLGPALRSLSICWHSSRVQVCSVEDWLKSAFQRSICSRHESLVNDFLLQVCDSCS
ARFPQRREAPTASWWTPTAKG
Download sequence
Identical sequences H0XIJ9
ENSOGAP00000015939 ENSOGAP00000015939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]