SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016003 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016003
Domain Number 1 Region: 74-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016003   Gene: ENSOGAG00000028494   Transcript: ENSOGAT00000033789
Sequence length 200
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:625192:626614:-1 gene:ENSOGAG00000028494 transcript:ENSOGAT00000033789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFAMLRSAPPGRYLYPEVSPLSEDEDRGSESSGSDEKPCRMHTGRCGLQGARRRAGGRR
AGGGGPGAGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLR
LASSYISHLGNVLLVGEACGDGQPCHSGPNFFHAARSGSPTPPPPARDGENAQPKQICTF
CLSNQRKLSKDRDRKTAIRS
Download sequence
Identical sequences H0XIR3
XP_003802390.1.62490 ENSOGAP00000016003 ENSOGAP00000016003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]