SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016131 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016131
Domain Number 1 Region: 521-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-44
Family cAMP-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-43
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-19
Family Flavin-binding PAS domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016131   Gene: ENSOGAG00000026584   Transcript: ENSOGAT00000026554
Sequence length 989
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:16301134:16322834:-1 gene:ENSOGAG00000026584 transcript:ENSOGAT00000026554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKSSSRSLSQRLLSQSFLGSEGSHGRPGGLGSGPGRGKYRTVSQ
IPQFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESQRGACGYTCSPL
TMVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEPKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFHGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDMVVAILGKNDIFGEP
VSLHARPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLRDADGG
LQSSPRQAPGSQDPQSFFLSNNQSGSPPKLGPQLPSQGCSLLGPRSQTSMVAGPHAPGYP
DAAPSLSISDTSGLWPELLQQMPAMRSPPNSQGNPDCWSRELGSRLEQLQAQMNRLESRV
SSDLSRILQLLQQPIPQGNTSYIPAVPAVTDLALFPMASVTQGPGPTLPRSHLPPAQNPS
LDLDKYRTKQRNSSKMPRLVMATDKTLTASLEQEQPEGLLSPLASPLHPLEVQGLICSPR
FPSLPEHLGSIPKQLEFQRHGSDPGFVGS
Download sequence
Identical sequences H0XJ41
ENSOGAP00000016131 ENSOGAP00000016131 XP_003786258.2.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]