SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016134 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000016134
Domain Number - Region: 104-145
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000213
Family HLH, helix-loop-helix DNA-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016134   Gene: ENSOGAG00000031010   Transcript: ENSOGAT00000032838
Sequence length 196
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:21908286:21909222:-1 gene:ENSOGAG00000031010 transcript:ENSOGAT00000032838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRERRRGEGRGGGGRGGGVEAARGAARRGSAIRRQQYGRADPGAASWQRRWPARAGLGG
GVARARPHERPPARSALEPRRQRHGGAQVAVGGRIPDIPYAHSPSVRKLSKIATLLLAKN
YILMQAQALDEMRRLVAYLNQGQGLAAPVAAAPLTPFGQTPVCPFSAGTALGPCPDKCTA
FSGTPSSLCKHCGEKP
Download sequence
Identical sequences H0XJ44
ENSOGAP00000016134 ENSOGAP00000016134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]