SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016149 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016149
Domain Number 1 Region: 625-793
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.82e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000508
Further Details:      
 
Domain Number 2 Region: 64-266
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-45
Family DBL homology domain (DH-domain) 0.00046
Further Details:      
 
Domain Number 3 Region: 280-349,407-442
Classification Level Classification E-value
Superfamily PH domain-like 6.29e-17
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 484-585
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000452
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016149   Gene: ENSOGAG00000027013   Transcript: ENSOGAT00000033610
Sequence length 846
Comment pep:known_by_projection scaffold:OtoGar3:GL873800.1:469509:536338:-1 gene:ENSOGAG00000027013 transcript:ENSOGAT00000033610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTSFGTSPGYSCATDRAEEQRRQDRLPYIDDSPSSSPHLSSKGRGSRDALALGAPESTKA
SELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIF
FKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEK
CCQANAQFAEISENLRARSNKDAKDPVTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPS
SHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLR
HIFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDESEAAPNIPLVPDEELDA
LKIKISQIKSDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTF
LISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHNIPLTINKEDDES
PGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIEL
EGSQTLRLLCYEKCYNKTKMSKEDGETTDRLMGKGQVQLGPGFLQGLSWPRPGLNLPAII
EVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEE
VGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFY
PNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLAT
VFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSI
LFSTEV
Download sequence
Identical sequences H0XJ59
ENSOGAP00000016149 ENSOGAP00000016149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]