SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016240 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016240
Domain Number 1 Region: 373-502
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016240   Gene: ENSOGAG00000025974   Transcript: ENSOGAT00000026557
Sequence length 523
Comment pep:known_by_projection scaffold:OtoGar3:GL873562.1:12028021:12034604:1 gene:ENSOGAG00000025974 transcript:ENSOGAT00000026557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGMAFALLTSVPPVVGLYTSFFPVLIYSLLGTGRHLSTGTFAILSLMTGSAVERLVPEP
LGGNLSGIEREQLDAQRVGAAASVAFGSGALMLAMFALQLGTLSTFLSEPVVKALTSGAA
LHVLLSQLPSLLGLSLPRQIGCFSLFKTLAAVLTALPRSSAAELTISALSLALLVPVKEL
NVRFRDRLPTRIPGEVVMVLLASVLCFTSSLDTRYNVQIVGLLPGGFPQPVLPNLAEVPG
ILADSLPIALVTFAVSASLASIYADKYSYTVDFNQELLAHGVSNLISSLFSCFPNSATLA
TTSLLVDAGGNTQLAGLFSCTVVLSVLLWLGPFFYYLPKAVLACINISSMRQMFFQMQEL
PQLWRISRVDFLLQVPGLCILSYPTPLYFGTRGQFRHILEWHLGLGKGGKATTNLDGPPD
RVAEPVRVVVLDFSGVIFADAAGAREVVQVRRLASRCQDAGIHLLLAQCSASVLGTLTRA
GLLDRVTPEQLYVSVQDAAAHALERLVRRSIRRGSQKLLGCDK
Download sequence
Identical sequences H0XJF0
ENSOGAP00000016240 ENSOGAP00000016240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]