SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016278 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016278
Domain Number 1 Region: 423-685
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-78
Family Eukaryotic proteases 0.0000000269
Further Details:      
 
Domain Number 2 Region: 27-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-30
Family Spermadhesin, CUB domain 0.000000794
Further Details:      
 
Domain Number 3 Region: 184-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-29
Family Spermadhesin, CUB domain 0.00000162
Further Details:      
 
Domain Number 4 Region: 366-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000473
Family Complement control module/SCR domain 0.0000106
Further Details:      
 
Domain Number 5 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0000922
Further Details:      
 
Domain Number 6 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000372
Family EGF-type module 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016278   Gene: ENSOGAG00000031666   Transcript: ENSOGAT00000032562
Sequence length 686
Comment pep:known_by_projection scaffold:OtoGar3:GL873586.1:7765344:7779386:-1 gene:ENSOGAG00000031666 transcript:ENSOGAT00000032562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRLLVLLSLMCFSLATPMGPKWPEPVFGRLASPGFPGVYANDLERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGTKVLATLCGRESTDTERAPGNDTFYSLGSHLDVTFRSD
YSNEKPFTGFEAFYTAEDIDECQVSPEEAPACDHHCHNHLGGFYCSCRSGYVLHRNKHTC
SALCSGQVSTERSGELSSPEFPRPYPKLSSCTYSIRLEEGFSVILDFVEFFDVEAHPETQ
CPYDSLKIQTGKEEYGPFCGKTLPPRIETKSNTVTIIFVTDESGDHKGWKIHYTSTALPC
PNPMAPPNGHISPMQAKYILKDNFSIFCETGYELLQGHLPLKSFTAVCQKNGSWDQRMPE
CSIVDCGPPDDLPCGRVEYVTGPEVTTYKAVIQYSCEETFYMMKTGDGKYVCEADGFWTS
SKGEKSLPVCEPVCGLSTRTTGSRIYGGQNAKLGDFPWQVLLSGGTTAAGALLYDNWVLT
AAHAVYKQKDDASSLDIRMGALKRLSLHYTQAWAEAVFIHEGYTHNAGFDNDIALIKLKN
KVVINSNIMPICLPRKEAESFMRTNDIGTASGWGLTQRGFLARNLMFVDIPVVDHQKCTA
AYEKQPYPGARVTDNMLCAGLESGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINC
GEAGQYGVYTKVSNYIPWIKNIMNNF
Download sequence
Identical sequences H0XJI8
ENSOGAP00000016278 ENSOGAP00000016278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]