SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016304 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016304
Domain Number 1 Region: 12-93
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000458
Family Snake venom toxins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016304   Gene: ENSOGAG00000032853   Transcript: ENSOGAT00000029673
Sequence length 116
Comment pep:novel scaffold:OtoGar3:GL873810.1:102468:103227:1 gene:ENSOGAG00000032853 transcript:ENSOGAT00000029673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLTLFLVALVGLPLAQALECHVCAYNGDNCFNPMRCPAMATYCMTTRTYYTPTKMKV
SKSCVPRCFETVYDGYSKHASTTACCQYYLCNGASFATLGGLALGPILLATLWDLL
Download sequence
Identical sequences H0XJL4
XP_012669155.1.62490 ENSOGAP00000016304 ENSOGAP00000016304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]