SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016316 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016316
Domain Number 1 Region: 457-650
Classification Level Classification E-value
Superfamily RNI-like 9.42e-32
Family 28-residue LRR 0.0011
Further Details:      
 
Domain Number 2 Region: 1006-1083
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000122
Family Caspase recruitment domain, CARD 0.027
Further Details:      
 
Domain Number 3 Region: 59-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000195
Family RecA protein-like (ATPase-domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016316   Gene: ENSOGAG00000030180   Transcript: ENSOGAT00000024564
Sequence length 1083
Comment pep:novel scaffold:OtoGar3:GL873927.1:80463:133211:1 gene:ENSOGAG00000030180 transcript:ENSOGAT00000024564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLSWKNEDLHKKFTQLLLLQRPHPRSLKSLVRRKRQVPIMENQGHLIEIRDLFGPGLGAQ
EEPRIVILHGAAGIGKSTLAREVQRGWEEGQLYQDRFQHVFYFSCAELAQSKVMSLADLI
TQAQEAPPASLQQVLSRPEQLLFILDGVDEPRWVLQQQNAEFCQHWSQPQQVAMLLGSLL
GKTILPEASFLITTRTVALQQLIPSLKQPRWVEVLGFSESSRKEYFYSYFTVKSQALRAL
SLVESNPAVWTMCLMPWLSWLVCTCLKQQMERGEDLTLTTMTVTGLYWCYLSQALPAQPL
RPHLRSICSLAAEGIRRKRSLFSPGDLRRHGLNGRIISTFVTMGVLLKHPNSRVYSFIHR
CFQEFLAAVSYVLGDEKRGEHCNSIRGVRGLPQAHKTHVLSRAPTRRFLFGLLGEQAGRE
MESIFTCQRAPELKQELLQWAKREACVLQSPQLPGFLELFYCLYETQDEEFVTQVMVHFQ
GSSVCVQTGMELLVFTFCIKFCHHMKRLQLNKDLVVGINLSLCSNVYFMQIPVTDACWQP
LFSILEVTGSLKELDLSGNSLSHSAVQSLRKTLRRPRCHLETLRLVSCGLTFSCCKDLAS
VLSTSPSLKELDLRWNNLGDLGVRQLCEGLRHPTCSLTLLWLDQAFLGEKMKEELRTLEK
EKPALLISSRWERGPRTPSGWCRLRAEPRDRQISRSKSAKVSGTFHMEPPGTEDEFLGPM
GPVAAEVVDIETRSLYRWEKVSFTTYIYRHCDKDGYHFKMERSKTSLFLAGLNSQFCTYT
LLINNHSITSVTLPLPYRQGEETTPPVSHHYMMLESSITFQDSAKISMAHTQHHIIFIQT
KQLISEHLTINEKTSETKIKVLLTKLDSVRALNPCLSILLLYRRPPNDCSIQKAIDDEEK
KFQFVRIHKPNLLTSLYMGSRYSVSGSGKLEMIPNELELCYRSPGEAQMFSEFYVAHMES
GFRLQMRDKKHRTVVWKALVKPDKLSPMLPRLSGQTEAPDSSHREEPHKHQLVARVTSVD
SVLDKLYGQVLSEEQYKQVRAEVTRPDQMRKLFSFSKSWDQACKDRLYQALKETHPHLIM
DLL
Download sequence
Identical sequences H0XJM6
ENSOGAP00000016316 ENSOGAP00000016316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]