SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016370 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016370
Domain Number 1 Region: 84-217
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.97e-47
Family Regulator of G-protein signaling, RGS 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016370   Gene: ENSOGAG00000028530   Transcript: ENSOGAT00000028001
Sequence length 223
Comment pep:known_by_projection scaffold:OtoGar3:GL873590.1:6241796:6262909:-1 gene:ENSOGAG00000028530 transcript:ENSOGAT00000028001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLPPQPMGSERTETRKRPPPAPQEAPDAPGPQAAESRGSNACCFCWCCCCSCSCLTVRN
QDQRSTRASHELRTDQLPTCEESPTPTLEEVHAWAQSFDKLMITPAGRNAFREFLRTEFS
EENMLFWMACEELKKEANKNMIEEKARMIYDDYISILSPKEVSLDSRVREVIDRNMGEPS
QHVFDDAQLQIYTLMHRDSYPRFMNSALYKDLLQSLSEKSVEA
Download sequence
Identical sequences H0XJT0
ENSOGAP00000016370 ENSOGAP00000016370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]