SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016415 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016415
Domain Number 1 Region: 71-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016415   Gene: ENSOGAG00000010106   Transcript: ENSOGAT00000010107
Sequence length 187
Comment pep:known_by_projection scaffold:OtoGar3:GL873661.1:2789330:2789893:-1 gene:ENSOGAG00000010106 transcript:ENSOGAT00000010107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTKSRPPRRGAPPQDAEAAPGERTPDGSSPDTGPDPSKGVRSRAVRATGARTEGGRRRS
GPGPGGRRDSSVQRRLESNERERQRMHKLNNAFQALREVIPHVRTDKKLSKIETLTLAKN
YIKSLTATILTMSSGRLPGLEGQGPKLYQHLQQQQQQVGATLGAPEAQPQGHLQRYSTQI
HSFREGT
Download sequence
Identical sequences H0XJX5
XP_012666303.1.62490 ENSOGAP00000016415 ENSOGAP00000016415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]