SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016451 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016451
Domain Number 1 Region: 109-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016451   Gene: ENSOGAG00000029784   Transcript: ENSOGAT00000032282
Sequence length 319
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:46452177:46453878:1 gene:ENSOGAG00000029784 transcript:ENSOGAT00000032282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLSPPLRDVDLTGPDGSLCSFATADDFYDDPCFDSPDLRFFEDLDPRLVHVGALLKPE
EHSHFPAAVLPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLREQDAAPPGAATAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGTRRRNCYEGAYYSEAPSEARP
GKNAAVSSLDCLSSIVERISTESPAAPALLLADAPPGSPPRPQEATAQNEGELGAPTPSP
DAAPQCPAGANPNPIYQVL
Download sequence
Identical sequences H0XK11
ENSOGAP00000016451 ENSOGAP00000016451 XP_003781197.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]