SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016459 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016459
Domain Number 1 Region: 397-455,580-796
Classification Level Classification E-value
Superfamily RNI-like 1.12e-37
Family 28-residue LRR 0.00011
Further Details:      
 
Domain Number 2 Region: 2-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000674
Family G proteins 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016459   Gene: ENSOGAG00000027032   Transcript: ENSOGAT00000030873
Sequence length 796
Comment pep:novel scaffold:OtoGar3:GL873927.1:6715:20220:1 gene:ENSOGAG00000027032 transcript:ENSOGAT00000030873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPHIVILHGAAGIGKSTLARQVQRGWEKGQLYQDRFQHVFYFSCAELAQSKVMSLADLIT
KAHGCPPVPLQQVLSQPEQLLFILDGVDEPRWVLWQESTELCQHWSQPQQVATLLGSLLG
KTILPEASFLITTRTVALQKLIPSLEQPRWVEVLGFSESSRKEYFYNYFIDESQALRALS
LVESNPAVWTMCLVPWLSWLVCTCLKQQMEMGEDLTLTTPTATGFCLRYLSQALLAQPLG
PRLRGICYLAAEGIRQKRSLFTPRDLRKHGLEEAIISTFVKIGVLQKHPNSRGYSFIHLC
FQEFFAAVACALGDEKERREHPDSIKGVGGLLQAYETHNLLWTPTARFLFGLLSEQAGRE
MESIFTCQRAPELRWELLQWAKREAQGLWSPWKPGFLELFHCLYETQDKEFLTQVMCHFL
ASSVCVQTHMELLVFTFCIKFCHHVKRLQLHDVGQHRPRWRPPGIVLHPIRTTECDPLLV
LKVWIRYYCSPGKKVSTLETRKEKILRGRNVRLRSFIFRFFSVASGSGMMWRHKMANAST
QFCRFGGRWIKDGEKLECIKSKNRKMSLKLEIELKKVNHGCSLCHLLLQTLSVVLLSLEG
DRVPRHWESRISMPKENRRVCIKEKKAVHFMQVPITGACWELLFSILEVTGSLKELDLSG
NLLSHSAVQSLSETLRRPRCHLETLRLACCDLTLEDCKDLALGLSQTLTELELSFNMLMD
AGAKYLCWELRQNCTLQRLQLVSCGLTSSCCQDLASVLSTSPSLKELDLQQNDLGDHGVR
LLCEGLRHPVCSLTLL
Download sequence
Identical sequences H0XK19
ENSOGAP00000016459 ENSOGAP00000016459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]