SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016525 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016525
Domain Number 1 Region: 93-280
Classification Level Classification E-value
Superfamily TRAF domain-like 3.6e-48
Family SIAH, seven in absentia homolog 0.000000158
Further Details:      
 
Domain Number 2 Region: 33-92
Classification Level Classification E-value
Superfamily RING/U-box 0.000000404
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016525   Gene: ENSOGAG00000026459   Transcript: ENSOGAT00000030068
Sequence length 283
Comment pep:novel scaffold:OtoGar3:GL873636.1:4149406:4150257:-1 gene:ENSOGAG00000026459 transcript:ENSOGAT00000030068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRPDRARPAGPSQGPPRQGEPDLSAMTPSSSHLRSLFECPVCFDYVLPPILQCQRGHL
VCISCRQKLTSCPTCRGPLGSIRNLAMEKVADSLSFPCKYAPSGCRITLPPAGKADHEEV
CDFRPYSCPCPGVLCPWEGSVDAVMPHLMDQHGSLTALEGETAIFLAMNINNEHGTFYWV
MMQSCFDLHFMVVLQKQENHHGEERFCAIVQLLGTPQQAQNFTYQLEVKGDRRRLTWRAT
PRSIREGIETAMMSNDCLVFDTNTAQLFAENNELSITVTIAEY
Download sequence
Identical sequences H0XK85
ENSOGAP00000016525 ENSOGAP00000016525 XP_003797551.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]