SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016545 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016545
Domain Number 1 Region: 163-412
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.54e-60
Family Voltage-gated potassium channels 0.00054
Further Details:      
 
Domain Number 2 Region: 37-134
Classification Level Classification E-value
Superfamily POZ domain 3.4e-27
Family Tetramerization domain of potassium channels 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016545   Gene: ENSOGAG00000005312   Transcript: ENSOGAT00000005315
Sequence length 495
Comment pep:known_by_projection scaffold:OtoGar3:GL873623.1:3755808:3757295:-1 gene:ENSOGAG00000005312 transcript:ENSOGAT00000005315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVMSGENVDEASATPGHPQDGSYPRPADHEDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNNNIFTDPFFIVETLCIIWFSFELVVRF
FSCPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDVNNSIAHYRQANIRTGNCTT
ANQNCVNKSKLLTDV
Download sequence
Identical sequences H0XKA5
ENSOGAP00000016545 ENSOGAP00000016545 XP_003796467.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]