SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016546 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016546
Domain Number 1 Region: 100-321
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-30
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016546   Gene: ENSOGAG00000025257   Transcript: ENSOGAT00000032644
Sequence length 1150
Comment pep:known_by_projection scaffold:OtoGar3:GL873621.1:2179797:2361246:-1 gene:ENSOGAG00000025257 transcript:ENSOGAT00000032644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRYIEENEDDGGEWRRRACTSEIQTGFILSSFATFLGGLFILYLFRLIRRSLIKWENIK
GTGIILKLVTSETFYQPYDRKLHFRGIFRDRIEMLLSAQTFVGQVLVILVFLLSIGSLII
YFINSTDPVGRCASYEDNTIPIDLIFNAFFSFYFGLRFLAADNKIKFWLELNSIVDIFTV
PPTFISFYLKSNWLGLRFLRALRLLELPQIMQILGALKTSNSVKFSKLLSMIFSVWFTAA
GFIHLVENTGDPWLKGTNSQNISYFDCFYLVMATTSTVGFGDVVAKTTLGRTFIMVFTLG
SLILFANYVPEMVELFANKRKNTTCYEVVKGKKFIVVCGNITVESVTAFLRNFLRHKSGE
INTEIVFLGESPPSLELETIFKCYLAYTTFVFGSARKWEDLKRVAVRTSFIFSPVSFPNY
CKQTKQEEIPSITALGIQIPYYCSDSTTTTKILSSSKVYLPKIPTWNWITGDNIICFAEL
KLGFIAQGCLVPGLCTFLTSLFVEQNKKIFPKKSWKKLFLNGMKNKIFTQRLSDDFVGMS
FPEVALLCFMKMHLMLIAIEHKSFIQSGYCGLVLNPPAQIRLQRNTVGFFIADSLKKVRR
AYLYCSICHSDVYSPEQIAKCGCKGKIRRHMTDPVIRIVQFGVKRNGKRLAWQSNQGEVH
ISPSMALDLTDKSFPHVIDQDTDPLDSSGMFHWCRSTPLDKMVLKRTEKSKHEFQNHIVA
CVFGDAHSTLLGLRNFVMPLRTSNYTRQELKDIVFIGSLDYLQREWQFLRNFPQVYIMPG
SALYAGDLHAVNIEKCFMCAVLCPPSKPSSSHTLVDTETIMATLNIGSVRVNTSSKPFSV
ADNISIYSNEPSGKSKHRRVPFLTELKNPYNIHFIEQLGGLEEAMPGTDLHLSTSFATGT
VFSDSFLDSLLATAFYNYRVLELLQMLVTGGVSSQLEQHLDKEKYSNADSYTTIMTGKSR
CKLELLPLHQTILSDVEPKKNFGQLFCGSLDRFGILCIGLYRLINEEELNPESKRFVITR
PENEFLLLPTDLVYCAIPFSLDCNQKKDAETDGMPYETVNIEPLTPEKSPDAKHPSKTDI
IKETTSPTVQVPVQPLQSGIFAPKQDVLKQSSKNTIQSSQVLPGDNVQEKGKGGQEQSRD
EDNVAFSSEL
Download sequence
Identical sequences H0XKA6
ENSOGAP00000016546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]