SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016550 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016550
Domain Number 1 Region: 90-256
Classification Level Classification E-value
Superfamily TRAF domain-like 5.62e-40
Family SIAH, seven in absentia homolog 0.00000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016550   Gene: ENSOGAG00000033062   Transcript: ENSOGAT00000025072
Sequence length 267
Comment pep:known_by_projection scaffold:OtoGar3:GL873562.1:3828370:3893885:-1 gene:ENSOGAG00000033062 transcript:ENSOGAT00000025072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTHNLKYVSSRRALAQSTSEQ
GSFHPHHLTHHCCHQRHHHHLRPHARPHLLHHQEAGLHAAPVTPCVCPLFSCQWEGHLEV
VVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGHPQ
FFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLDCVDSVITDGDCLVLNTSLA
QLFSDNGSLAIGIAITSTEVGSSEAEM
Download sequence
Identical sequences H0XKB0
XP_012661007.1.62490 ENSOGAP00000016550 ENSOGAP00000016550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]