SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016576 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016576
Domain Number 1 Region: 224-477
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.06e-55
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 36-151
Classification Level Classification E-value
Superfamily POZ domain 1.62e-29
Family Tetramerization domain of potassium channels 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016576   Gene: ENSOGAG00000033120   Transcript: ENSOGAT00000028012
Sequence length 626
Comment pep:known_by_projection scaffold:OtoGar3:GL873529.1:1271484:1292020:-1 gene:ENSOGAG00000033120 transcript:ENSOGAT00000028012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWLADPDGGGRPETDGAGAGSSGSNGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPAD
VCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGGGAGPNDEAG
DDERELALQRLGPHEGCAGSGSGSGSCRGWQPRMWALFEDPYSSRAARVVAFASLFFILV
SITTFCLETHEAFNIDRNVTEIHRVGNITSVRFRREVETEPILTYIEGVCVLWFTLEFLV
RIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIF
KLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHT
DFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMY
YSLAMAKQKLPKKRKKHVPRPAQLESPMYCKSEETSPRDSTYSDTSPPAREEGMVERNRA
DSKQNGDANAVLSDEEGGGLTQPLASAPTPEERRALRRSATRDRNKKAAACFLLSTGDFA
CADGSVRKEGNVEPKVCVPVSHTCTL
Download sequence
Identical sequences H0XKD6
ENSOGAP00000016576 ENSOGAP00000016576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]