SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016622 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016622
Domain Number 1 Region: 94-314
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-55
Family DBL homology domain (DH-domain) 0.0000529
Further Details:      
 
Domain Number 2 Region: 299-441
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-31
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016622   Gene: ENSOGAG00000033661   Transcript: ENSOGAT00000031065
Sequence length 1390
Comment pep:known_by_projection scaffold:OtoGar3:GL873645.1:5417227:5502853:-1 gene:ENSOGAG00000033661 transcript:ENSOGAT00000031065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSNSHLGLFNQDKEAGAIKLELMPAR
QFSSSDLQRDNPTGHQNTNEGSDRQSRTQRRTDTSGSPKTAADSAPSPKLLYVDRVVQEI
LETERTYVQDLKSIVEDYLDCIRDQTKLPLGTEERLALFGNIQDIYHFNSILTKNMVNCF
LKDKVGSEECVVSDSEEFHIYTQYCTNYPRSVAVLTECMRNKILAKFFRERQETLKHSLP
LGSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHA
VRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRDDTFTY
KAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHA
AKIPAKAKQAILEMDAIHHPGFCYSPEGETKAVCGSKEGSTPYRLRRKSEPSSRSHKVLK
TSETTQDIQKVSREEGSPQLTSARPSPTQRNSQPSSSATIGMFRGSGTARNIWTDHQIRQ
ALFPSRRPAQEDEDDEDDYQMLVPSFSSSDLNSARLREESTSSRPCSWHMGQIESTEIPS
SGHRIVRRASSAGESNTCPPEVRIRDSDGSQFSPRRELQNGPKTEEQEGMTPFGSSTELT
VDDIDHVYDNISYEDLKLMVAKREEAESTPPRSARDSIRPKSTPELAFSKRQAGHPKSFL
FTQKDGVLMGQEASSQSTHELQVVEENIYDTIGLPEPPPLDFQCGSLKRPKRSTFLGLEA
DFVCCDSLRPFISQDSLQFSEELPSRQGASDEDYLSLLHTSSSCDLSAADKPVSDKLSEE
VDEIWNDLENYIKKNEDKARDRLLAAFPVSQDDVPAGLHAERSPQLGRHAAHSASALSLP
ESQVFPTPGKSRAIRASRVNYPFEEDLISREGSFVSLNRLSVASETPPVDNPYDLADSSL
SQTDPENPDLGMEAADKTKSRVFMMARQYSQKIKKANQLLKVKSPELEQPPASQHPKSTH
RDLAAILEEKRQGGPAIGARIAEYSQLYDQIVFRETPLKIQKDDWASPRESSLLRSSSPS
QVQQRSEDWLLHSTYSNGELADFCPQPEQDLRSRYPTLEMGTKSTPRQLSAACSVPSLQT
SDPLPGSLQRCSVIVSQPNKENLCQGHLYNSVGRKGTSAKYQPYNRSQSSSSILINKSMD
SINYPSDLEKQQLLSLQRSSRCESHQNLLPGPADSHPQGSDQLSDLTLQDSQKVLVVNRS
LSLNAQIATQNYFSNFKEAEGDEDDYVEIKSEEDESELEPSHGRRRKSDLRMMHAGYSDN
GSGNPSHSADSPCTPPKPIHSKLELSPYLTSCNDSDKLSDYLWRGPSPNQQNIVQSLREK
FQCLSSSSFA
Download sequence
Identical sequences H0XKI2
ENSOGAP00000016622 ENSOGAP00000016622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]