SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016624 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016624
Domain Number 1 Region: 401-630
Classification Level Classification E-value
Superfamily RNI-like 6.67e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 2 Region: 73-151
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000184
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016624   Gene: ENSOGAG00000033216   Transcript: ENSOGAT00000028193
Sequence length 651
Comment pep:novel scaffold:OtoGar3:GL873666.1:1546982:1549274:1 gene:ENSOGAG00000033216 transcript:ENSOGAT00000028193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGRPKGKLGPSSAMKLADNRTTAGARGRRTRCRKCEACLRTECGQCHFCKDLKKFGGPGR
MKQSCIMRQCIAPVLPHTAVCLVCGGAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLK
IKESEGVVNDELPNCWECPKCNHTGKTGKQKRGPGFKYPSNLPGSLLKEQKMNPDIKDGQ
EPTKQRGECKEAPRRRSDEHPKKVPPDGILGYRGPDGTGQQAPLAFKEEPEDDLPEAPPK
TRRVTTHAPALPPLGPPPRELSVWRRTRRELRKELNHEIQKTESSLANQNHQSIKSEPES
EKEEPKCPRGLYERPHRFSKGLNGTPQELRHQLEPSLCSPPHVISWPPSSVSPPKCIQRV
RHVRPLPIRPPPNSLPLEDGAAHVMHREVWMAIFSYLSHQDLCVCMRVCRTWNRWCCDKQ
LWTCIDLNHRKSITPLMLSGIIRRHPVSLDLSWTNISKKQLSWLITRLPGLQDLVLSGCS
WIAVSVLCSSSCPLLRTLDIQWVEGLKDAQMRDLLSPPTDNRPGQMDNQSKLRNIVELRL
VGLDITDASLLLIIHMPLLSKLHLSYCNQSINLLTAVGTTTRDSLTEINLSDCNKVTDQC
LSFFKHCGNICHIDLRYCKQVTKAGCEQFIAQMSVSVQFGQVEEKLLQKLS
Download sequence
Identical sequences H0XKI4
ENSOGAP00000016624 ENSOGAP00000016624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]