SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016663 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016663
Domain Number 1 Region: 52-426
Classification Level Classification E-value
Superfamily RNI-like 1.12e-64
Family 28-residue LRR 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016663   Gene: ENSOGAG00000027337   Transcript: ENSOGAT00000027525
Sequence length 708
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:2316396:2368972:1 gene:ENSOGAG00000027337 transcript:ENSOGAT00000027525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPPQEAPPGPGADCDADEAPAEAESSSPASPPADGRLKVAAKRVTFPSDEDIVSGAVE
PKDPWRHAQNVTVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRIDCLDLKGEKLD
YKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGW
QAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENSSLSGRPLMLLA
TALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGL
KEQRKGLVTLVLWNNQLTHTGMAFLGMTLPHTQSLETLNLGYNPIGNEGVRNLKNGLIGN
RSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLL
RLDIDREPKKEAVKSFIETQKALLAEIQNGCKRNFVLAREREEKEQRLQLSASMPEITIT
EPQPDEEPSHQEPMDEPIAGAQNGAPSPGPSPDSDSDSDSDGEDEEEEDGKKDKANGNQS
PSAPCPALVPPTDSLGPGDRSPPGSPCSPTEQRISVSSPGRGHKVFVVTRVESPPERADL
PVCPIPYSPPALTSLPASPALPPAGAIGTQDPGSSEPQPQPEPPQSGPLLPNGLKPEFAL
ALPPEPPPGPEAKGGSCGLEHELSCSKNEKELEELLLEASQESGQETL
Download sequence
Identical sequences H0XKM3
ENSOGAP00000016663 XP_003799551.1.62490 ENSOGAP00000016663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]