SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016721 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016721
Domain Number 1 Region: 14-139
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-47
Family Regulator of G-protein signaling, RGS 0.00000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016721   Gene: ENSOGAG00000026793   Transcript: ENSOGAT00000028148
Sequence length 152
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:2642771:2663211:-1 gene:ENSOGAG00000026793 transcript:ENSOGAT00000028148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKGRCCFYRSPATEALAWSENMDTLLANEAGLDAFRKFLQSEFSEENVEFWLACEDFKKT
ENVEKIASKAKMIYTEFIEADAPKEINIDFSTRDLISKNIAEPTLKCFDEAQKLIYSLMA
KDSYPRFLKSEIYKKLVNSQQVTNHKKWLPFL
Download sequence
Identical sequences H0XKT1
ENSOGAP00000016721 ENSOGAP00000016721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]