SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016747 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016747
Domain Number 1 Region: 523-702
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-37
Family DBL homology domain (DH-domain) 0.00000428
Further Details:      
 
Domain Number 2 Region: 715-838
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-25
Family Pleckstrin-homology domain (PH domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 238-342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000694
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 31-113
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000615
Family CRAL/TRIO domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016747   Gene: ENSOGAG00000000662   Transcript: ENSOGAT00000028503
Sequence length 838
Comment pep:known_by_projection scaffold:OtoGar3:GL873685.1:2334841:2474376:-1 gene:ENSOGAG00000000662 transcript:ENSOGAT00000028503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTYSLTLPTLCSAEAASIGFIIVIDRRRDKWSSIKASLTRIAVAFPGNLQLVFILRPSCF
IQRTFTDIGIKYYREEFKMKVPIILLNSVSDLHGYIDKSQLTQELGGTLEYRHSQWINHR
TAMENFALTLKASAQMLQTFGACLASIELPRGMSSTEDLLMSHRRQRDKLQNELKLLGKQ
GATLLSCIQEPAVINPAGKLNPNELENVVTMERLLVQLDETEKAFSQFWFEHHEKLNQCL
QLQHFEHNFCKVKLALDNLLEEQAEFTGIGGSVTHVEQLLKEHKKLEEKGQESLEKAQLL
ALAGDQLIQSHHYAVDSIRPRCVELRHLCDDFINENKKKYDILGKSLELHRQLDKVSRWC
EAGIYLLASQPVDKCQSREGVDIALNDIETFLSTAKEYQLPSPKEFYNQFELILTLDVEA
KAQKVLQKLGDVQEIFHKRQVSLMKLAAKQTRPVQPVAPHPESSPKCKVPPTGFGIRQGS
EENITFSNGILRHWDYRLFRSFLNKSRQERGGAGRREDFRPLLQFRSLIRDLLQTEEIYI
KEIKSIIDGYIIPMDFIWLKHLIPDVLQNNKDFLFGNIRELYEFHNRTFLKELEKCAENP
ELLAHCFLKRKEDLQIYFKYHKNLPRARAIWQECQDCAYFGVCQRQLDHNLPLFKYLRGP
SRRLIKYQMLLKNGPKRTKDSPFSAELQQALAVIEDLIKSCELAVDLAAVTGCPDDIGKL
GKMLMHGAFNVWTIHKDRYKMKDFIRFKPSQRQIYLFERGIVFCKIHTEPGDQGLSPCYS
FKKSMKLMTLSIHQVGRGSNKKFEIASRNGLEKYILQAASKEIRDCWFSEISKLLMEQ
Download sequence
Identical sequences H0XKV7
ENSOGAP00000016747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]