SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016756 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016756
Domain Number 1 Region: 1422-1528
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1559-1665
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000916
Further Details:      
 
Domain Number 3 Region: 1037-1143
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000603
Further Details:      
 
Domain Number 4 Region: 1164-1269
Classification Level Classification E-value
Superfamily SRCR-like 1.22e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 5 Region: 131-236
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 6 Region: 267-370
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 7 Region: 903-1006
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 8 Region: 3-103
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 9 Region: 400-505
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 10 Region: 509-612
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 11 Region: 640-744
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 12 Region: 1806-1908
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 13 Region: 772-875
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 14 Region: 1296-1393
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016756   Gene: ENSOGAG00000030945   Transcript: ENSOGAT00000028902
Sequence length 2325
Comment pep:novel scaffold:OtoGar3:GL873594.1:9485963:9591718:-1 gene:ENSOGAG00000030945 transcript:ENSOGAT00000028902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIVQLMEGSGRCSGRVEVYFEGVWGTVCDDFWDEKAAQVVCWQLGCGTAISAPGEAYFGQ
GSGSILLDNVQCSGSESNLGLCSHAGWFTHNCEHGEDAGVICSVKRPQPTKRLDKWVDAE
LVPSPNISSKDWPQMQLVNGSGRCSGRVEVFYHGRWGRVCDDQWDMNEANVVCRQLGCGR
ALAAPAEAEFGEGKGQFLLDDVDCSGKESFLGQCPHAGWGVHNCGPREDASVVCTENAEG
SLQVPQAQTWNLSHRKFVENQSSSKHWPTLRLVNGTGRCSGRVEVSYHGSWGTVCDDGWG
LSEAQVVCRQLGCGPAVSAPLGAHFGPGFGKIVLDNVRCSGEEASLALCAHDSWFTHDCS
HEKDAGAICSVSGAFSEPSLTTAPEILTPPPTVCASPGAWIEVRLLNGTGRCSGRVEVLI
QDTWGTVCDDLWDLAEATVVCRQLRCGHAAAAPTGAHFGAGSGKILLDDVQCVGSEGHLG
QCVHNGQARHNCGHLEDASVICTGPGFRMEVKLLNGTGRCSGRVEVLIQGTWGTVCDDLW
DLAEATVVCRQLQCGHAVAAPTGAHFGAGSGKILLDNVQCLGSEGHLGQCMHRDQAGHNC
GHLEDAGVICAGADGSPAPIPNPTTEPEAAPPSDMLPGAWMEVRLLNGTGRCSGRVEVLI
QGMWGTVCDDFWDVAEATVVCRQLQCGHAVAAPTGAHFGAGSGKILLDDVQCVGSEGHLG
QCVHGGQARHNCGHLEDAGVICAGADGSSAPIPTPTTEPEVASPSDMLPGAWMEVRLLNG
TGRCSGRVEVLIQGTWGTVCDDFWDVAEATVVCRQLQCGHAVAAPTGAHFGAGSGKILLD
DVQCVGSEDHLGQCMNRGQARHNCGHLEDAGVICAVAHENLLPTSSVVPVAQHPPPSTPP
GGWAPVRLVGSQGSCAGRVELFYQGVWGTVCDDLWDLPAANIVCRQLECGWAISALGEAH
FGEGSGKILLDNVHCRGDEQHLEECSHIGWFSHNCGHGEDASVICSVSSFAPASCTETWP
TAMLQRTAVTRSLSAGDWPELRLVGGSGPCSGRVEVLHQGTWGTVCDDLWDLNEAEVVCR
QLRCGQAVSALGKARFGPGSGDILLDNLQCAGVERHLGQCTHSGWLEHNCGHHEDAGVIC
SGKEIKLTEDPTTCHSETHEKWDRPELRLVGGPGRCSGRVEVLHEGVWGTVCDDLWDLNE
AQVVCRQLQCGQAVSSPGEAHFGPGSGDILLDNLQCSGVEHYLDQCGHSGWSEHNCGHHE
DAGVICTGIFSPRASPPDQALISGTGSDLGSSGVTQGSPCQRRVDIVQGGFWGTMCNNLW
DLSEAEVVSQHLGCGWAIAVPGKAHFGPGSGDILRDDIQCSGIEQHPGLCPSSGWSDHNC
GHHEDAEVICSSSLSFHGVAPAPPGTWPRKNGIRGSALGKTQYTSLRLVNGSHRCEGRVE
VFYNGTWGTVCDDSWDLADARVVCRQLGCGKALSAPVKNHFDGGTGHVMLDDVQCTGNEI
KVWQCMHSGWFSHNCGHHEDASAICSGVDGNSHPGPTEWKTSMAVHTTLLKSLTVHKSGD
VALRLTNGRHRCEGRVELRYNGSWGTVCDDSWDMQDAQVVCRQLGCGAAVAAPGQAHFAR
GLGAIVLDDVECAGTEARLWQCLHSGWLNHNCGHHEDASAICSGCKIKITTNHLYHPPTN
RTSSPVFSSCGHLLYGTGGPFEMSSWACSLPTQVVCLSNDPGPNFLDNVRFMGNNTSLGR
HQHPGHSFITVDSIRMQGPTCPDQVFPSSTDRSHPGSYFVSNFNVSEIGYIYFLNSFPKN
LIIKFLSLFGGPSRCEGRVEVLHGGVWGTVCDDNWNIKNARVVCRLLGCGPALGAPGHGR
FGPGAGPILLDDVRCTGFEDELGRCSHSGWGHHNCHHREDAGVVCAGTVGPQPPEPTANY
TLPSLSSQCIPCLGPSGDPGLPFLFPWSILPLSYSSCHSEISLSFLSTSSLTPGYITLLQ
CLSTVDLCFPSFPPHQVQPTLLYLREKVGQEAPVCPGSLPLCYLFLQFTIIRRPRQTVLR
PSPSPPPAAQLSCLPHLFQATIDRGYLLRLGYSSWDIHLNDELCRPQITGRYLIFNIPYG
RCGTIQQEHLGSLSYSNSIRGRIRGHPGRVIVRHRVPELKFTCRAGGPAAVEVIHGADAP
TENANYEVSVAFLQSPGPQQVGSMAPYYASQGKEVFLQATLHSLDPNLMLFVDTCVASPD
PSDFTTSKYDLIQHGCIKDNSYVNLHSGQKNVVQFKFNAFSFLDSYDVVYVQCKIAVCKV
RDSSRCSQGCAGRSRRSLGASEAKDEQTEHFQTVGPLEIHKEPPR
Download sequence
Identical sequences H0XKW6
ENSOGAP00000016756 ENSOGAP00000016756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]