SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016772 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016772
Domain Number 1 Region: 127-319
Classification Level Classification E-value
Superfamily E set domains 2.71e-67
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000055
Further Details:      
 
Domain Number 2 Region: 25-143
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.48e-23
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016772   Gene: ENSOGAG00000005700   Transcript: ENSOGAT00000030136
Sequence length 329
Comment pep:known_by_projection scaffold:OtoGar3:GL873730.1:2139245:2142225:-1 gene:ENSOGAG00000005700 transcript:ENSOGAT00000030136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRGRFVKKDGHCNVRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGL
AFWLIASLHGDLAAPPPPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAV
VLQCIAGCVLDAFVVGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSH
LVEAHVRAQLLQGSQGQENRCPPSILVSSLSTDRIFLVSPITIVHEIDSSSPLYELGRAE
LARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHR
TYEVPGTPVCSAKELDERAERASNSPKSS
Download sequence
Identical sequences H0XKY2
ENSOGAP00000016772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]