SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016829 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016829
Domain Number 1 Region: 40-119
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000201
Family Linker histone H1/H5 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016829   Gene: ENSOGAG00000024640   Transcript: ENSOGAT00000027592
Sequence length 223
Comment pep:known_by_projection scaffold:OtoGar3:GL873620.1:2847170:2847933:1 gene:ENSOGAG00000024640 transcript:ENSOGAT00000027592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEEALPLTTAERAAKKATRASNSAALSPSKKRKNKKKNQPGKYSQLVVETIRRLGERNGS
SLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGG
ERRGAPAAATALAPTAHKAKKAAPGAAGPRRADKKPARGQKPEKRSHKKGGASKKDKGSK
AKKAAAAGGKKVKKAAKPSVPKVPKGRKLPRARAAAPALSRRE
Download sequence
Identical sequences H0XL39
ENSOGAP00000016829 ENSOGAP00000016829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]