SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016839 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016839
Domain Number 1 Region: 84-289
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-55
Family SPRY domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 43-96
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000501
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016839   Gene: ENSOGAG00000033173   Transcript: ENSOGAT00000027982
Sequence length 292
Comment pep:known_by_projection scaffold:OtoGar3:GL873579.1:566650:582106:1 gene:ENSOGAG00000033173 transcript:ENSOGAT00000027982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPAGEVMAAPTPGAGGASGGAGCSSSGGAGAGSGSGSAGAGGRLPSRVLELVFSYLELS
ELRNCALVCKHWYRCLHGDENSEVWRSLCARRLAEEALRTDILCNLPSYKAKVRAFQHAF
STNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIA
TKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVIL
DMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences H0XL49
ENSOGAP00000016839 ENSOGAP00000016839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]